General Information

  • ID:  hor006105
  • Uniprot ID:  P01342
  • Protein name:  Insulin B chain
  • Gene name:  ins
  • Organism:  Myxine glutinosa (Atlantic hagfish)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Myxine (genus), Myxininae (subfamily), Myxinidae (family), Myxiniformes (order), Myxini (class), Cyclostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RTTGHLCGKDLVNALYIACGVRGFFYDPTKM
  • Length:  31(27-57)
  • Propeptide:  MALSPFLAAVIPLVLLLSRAPPSADTRTTGHLCGKDLVNALYIACGVRGFFYDPTKMKRDTGALAAFLPLAYAEDNESQDDESIGINEVLKSKRGIVEQCCHKRCSIYDLENYCN
  • Signal peptide:  MALSPFLAAVIPLVLLLSRAPPSADT
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01342-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006105_AF2.pdbhor006105_ESM.pdb

Physical Information

Mass: 398334 Formula: C154H240N42O42S3
Absent amino acids: EQSW Common amino acids: G
pI: 8.77 Basic residues: 5
Polar residues: 12 Hydrophobic residues: 10
Hydrophobicity: 6.45 Boman Index: -3166
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 75.48
Instability Index: 4430.65 Extinction Coefficient cystines: 3105
Absorbance 280nm: 103.5

Literature

  • PubMed ID:  6265453
  • Title:  Messenger RNA sequence and primary structure of preproinsulin in a primitive vertebrate, the Atlantic hagfish.
  • PubMed ID:  1097441
  • Title:  The amino acid sequence of the insulin from a primitive vertebrate, the atlantic hagfish (Myxine glutinosa).
  • PubMed ID:  4418746
  • Title:  Structural and crystallographic o
  • PubMed ID:  4427361
  • Title: